Rabbit anti‑Human ABCC4 / MRP4 IgG Polyclonal RW-C331977-20

Antibody: ABCC4 / MRP4 Rabbit anti-Human Polyclonal Antibody, Application: WB, Reactivity: Human, Mouse, Rat, Format: Unconjugated, Unmodified, Descriptio: MRP4 antibody RW-C331977 is an unconjugated rabbit polyclonal antibody to MRP4 (ABCC4) from human. It is reactive with human, mouse and rat. Validated for WB., Targe: Human ABCC4 / MRP4, Synonym: ABCC4 | EST170205 | MOAT-B | Multidrug resistance protein 4 | MOATB | MRP4, Hos: Rabbit, Reactivit: Human, Mouse, Rat (tested or 100% immunogen sequence identity), Clonalit: IgG Polyclonal, Conjugation: Unconjugated, Purificatio: Affinity purified, Modification: Unmodified, Immunoge: Recombinant fusion protein containing a sequence corresponding to amino acids 495-705 of human ABCC4 (NP_001098985.1). FGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYF, Specificit: Human ABCC4 / MRP4, Application: Western blot (1:500 - 1:2000), Usag: The predicted MW is 88kDa/96kDa/144kDa/149kDa, while the observed MW by Western blot was 170kDa., Presentatio: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol, Storag: Store at -20°C. Avoid freeze-thaw cycles., Restriction: For research use only. Intended for use by laboratory professionals., Guarante: This antibody carries the RW 100% Guarantee., About ABCC4 / MRP: Uniprot: O15439 NCBI: NM_005845 NP_005836.2

Internal Reference: RW-52-1918-113